PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013610539.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 267aa    MW: 30682.8 Da    PI: 6.2581
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013610539.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.92.4e-131461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +l + +   G ++W+ +++  g+ R++k+c++rw +yl
   XP_013610539.1 14 RGPWTIEEDHRLMNFILNNGIHCWRVVPKLAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding52.98.7e-1767110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +T  E++++ +++ qlG++ W++Ia+ ++ gRt++++k++w++
   XP_013610539.1  67 RGGFTDAEEDRIMELHSQLGNR-WSKIASLFP-GRTDNEIKNHWNT 110
                      788*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-20564IPR009057Homeodomain-like
PROSITE profilePS5129412.95961IPR017930Myb domain
SuperFamilySSF466897.49E-2811108IPR009057Homeodomain-like
SMARTSM007176.4E-61363IPR001005SANT/Myb domain
PfamPF002491.3E-111461IPR001005SANT/Myb domain
CDDcd001672.99E-41661No hitNo description
PROSITE profilePS5129425.48662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2565117IPR009057Homeodomain-like
SMARTSM007172.7E-1466114IPR001005SANT/Myb domain
PfamPF002491.5E-1467110IPR001005SANT/Myb domain
CDDcd001671.98E-970110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MGRKPCCEKI GLKRGPWTIE EDHRLMNFIL NNGIHCWRVV PKLAGLLRCG KSCRLRWINY  60
LRPDLKRGGF TDAEEDRIME LHSQLGNRWS KIASLFPGRT DNEIKNHWNT KIKKKMIHLG  120
LNQAAHEPIN SITSRTKPKQ ITNPNMSSTI TEKEETKEQR KDDVIIETTK PLIVSNNDEE  180
IQAENCKTLY AEEVDIGSLF AMQDNEISIS SSSFSSLYSN ISRSESSSYL AGDSISLEQW  240
DLDMTDPLVP WDLFTNLDDT LFLYDKM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-29121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00510DAPTransfer from AT5G14340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895640.0AC189564.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH009B23, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013610539.10.0PREDICTED: myb-related protein 315-like
TrEMBLA0A0D3EFK10.0A0A0D3EFK1_BRAOL; Uncharacterized protein
STRINGBra008764.1-P1e-175(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.11e-129myb domain protein 40